SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2Q2E9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2Q2E9
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 3.79e-83
Family CutC-like 0.0000017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2Q2E9
Sequence length 273
Comment (tr|H2Q2E9|H2Q2E9_PANTR) CutC copper transporter homolog {ECO:0000313|EMBL:JAA00528.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0004158 OC=Catarrhini; Hominidae; Pan.
Sequence
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGADRIELCSGLSEGGT
TPSMGVLQVVKQSVQIPVFVMIRPRGGDFLYSDREIEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLMAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTRDSGMKFRNSSV
AMGASLSCSEYSLKVTDVTKVRTLNAIAKNILV
Download sequence
Identical sequences A0A2K5IDX1 H2Q2E9 Q9NTM9
NP_057044.2.87134 NP_057044.2.92137 XP_003312774.1.37143 XP_003825506.1.60992 XP_011790955.1.43180 ENSPTRP00000004981 9598.ENSPTRP00000004981 9606.ENSP00000359507 ENSP00000359507 ENSP00000359503 gi|148596990|ref|NP_057044.2| ENSP00000359507 ENSPTRP00000004981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]