SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2QHT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QHT4
Domain Number 1 Region: 170-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.77e-48
Family Voltage-gated potassium channels 0.00089
Further Details:      
 
Domain Number 2 Region: 11-121
Classification Level Classification E-value
Superfamily POZ domain 2.09e-24
Family Tetramerization domain of potassium channels 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QHT4
Sequence length 436
Comment (tr|H2QHT4|H2QHT4_PANTR) Potassium voltage-gated channel modifier subfamily G member 3 {ECO:0000313|Ensembl:ENSPTRP00000020372} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0027962 OC=Catarrhini; Hominidae; Pan.
Sequence
MTFGRSGAASVVLNVGGARYSLSRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNE
YFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRM
SDTYTFYSADEPGVLGRDEARPGGAEAAPSRRWLERMRRTFEEPTSSLAAQILASVSVVF
VIVSMVVLCASTLPDWRNAAADNRSLDDRSRYSAGPGREPSGIIEAICIGWFTAECIVRF
IVSKNKCEFVKRPLNIIDLLAITPYYISVLMTVFTGENSQLQRAGVTLRVLRMMRIFWVI
KLARHFIGLQTLGLTLKRCYREMVMLLVFICVAMAIFSALSQLLEHGLDLETSNKDFTSI
PAACWWVIISMTTVGYGDMYPITVPGRILGGVCVVSGIVLLALPITFIYHSFVQCYHELK
FRSARYSRSLSTEFLN
Download sequence
Identical sequences A0A2I2ZP23 H2QHT4 Q8TAE7
ENSPTRP00000020372 ENSP00000304127 9598.ENSPTRP00000020372 9606.ENSP00000304127 ENSP00000304127 ENSP00000304127 NP_579875.1.87134 NP_579875.1.92137 XP_001138271.1.37143 ENSPTRP00000020372 gi|19071574|ref|NP_579875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]