SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2QYG4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2QYG4
Domain Number 1 Region: 6-115
Classification Level Classification E-value
Superfamily Histone-fold 1.84e-18
Family Nucleosome core histones 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2QYG4
Sequence length 117
Comment (tr|H2QYG4|H2QYG4_PANTR) Huntingtin interacting protein M {ECO:0000313|Ensembl:ENSPTRP00000037381} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0043412 OC=Catarrhini; Hominidae; Pan.
Sequence
MSEKKNCKNSSTNNNQTQDPSRNELQVPMSFVDRVVQDERDVQSQSSSTINTLLTLLDCL
ADYIMERVGLEASNNGSMRNTSQDREREVDNNREPHSAESDVTRFLFDEMPKSRKND
Download sequence
Identical sequences H2QYG4
XP_003317470.1.37143 XP_003815438.1.60992 ENSPTRP00000037381 9598.ENSPTRP00000037381 ENSPTRP00000037381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]