SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2R084 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R084
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 8.11e-20
Family Ribosomal protein L39e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2R084
Sequence length 51
Comment (tr|H2R084|H2R084_PANTR) Ribosomal protein L39 like {ECO:0000313|Ensembl:ENSPTRP00000040334} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0023449 OC=Catarrhini; Hominidae; Pan.
Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGSKIRSNSKRRHWRRTKLGL
Download sequence
Identical sequences H2R084
XP_003950300.1.37143 XP_008954121.1.60992 ENSPTRP00000027051 9598.ENSPTRP00000027051 ENSPTRP00000027051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]