SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2R3T7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2R3T7
Domain Number 1 Region: 45-198
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.12e-55
Family Dual specificity phosphatase-like 0.0000000384
Further Details:      
 
Domain Number 2 Region: 199-375
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.45e-48
Family Dual specificity phosphatase-like 0.0000000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2R3T7
Sequence length 498
Comment (tr|H2R3T7|H2R3T7_PANTR) CDC14B isoform 2 {ECO:0000313|EMBL:PNI22121.1} KW=Complete proteome; Reference proteome OX=9598 OS=Pan troglodytes (Chimpanzee). GN=CK820_G0047641 OC=Catarrhini; Hominidae; Pan.
Sequence
MKRKSERRSSWAAAPPCSRRCSSTSPGVKKIRSSTQQDPRRRDPQDDVYLDITDRLCFAI
LYSRPKSASNVHYFSIDNELEYENFYADFGPLNLAMVYRYCCKINKKLKSITMLRKKIVH
FTGSDQRKQANAAFLVGCYMVIYLGRTPEEAYRILIFGETSYIPFRDAAYGSCNFYITLL
DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY
HQHSPETYIQYFKNHNVTTIIRLNKRMYDAKRFTDAGFDHHDLFFADGSTPTDAIVKEFL
DICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIGPQQQFL
VMKQTNLWLEGDYFRQKLKGQENGQHRAAFSKLLSGVDDISINGVENQDQQEPEPYSDDD
EINGVTQGDRLRALKSRRQSKTNAIPLTVILQSSVQSCKTSEPNISGSAGITKRTTRSAS
RKSSVKSLSISRTKTVLR
Download sequence
Identical sequences H2PST4 H2R3T7 O60729
ENSPPYP00000021757 NP_201588.1.87134 NP_201588.1.92137 XP_002820045.1.23681 XP_009455213.1.37143 HR4745 O60729 ENSP00000364389 ENSPTRP00000046055 ENSPTRP00000046055 ENSPPYP00000021757 9598.ENSPTRP00000046055 9600.ENSPPYP00000021757 9606.ENSP00000364389 ENSP00000364389 gi|15451936|ref|NP_201588.1| ENSP00000364388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]