SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2RYC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2RYC4
Domain Number 1 Region: 275-409,441-507
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.49e-41
Family Hemopexin-like domain 0.00076
Further Details:      
 
Domain Number 2 Region: 64-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000288
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000863
Family Somatomedin B domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2RYC4
Sequence length 507
Comment (tr|H2RYC4|H2RYC4_TAKRU) Proteoglycan 4b {ECO:0000313|Ensembl:ENSTRUP00000005145} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
KMSSTVTFALVFLACALTLSTGQTSCKGRCGGEYYRGYTCQCDYTCLTYDECCDDYESQC
TTKNSCKGRCGEAFRRGRGCSCDPDCQKFKQCCSDFQTHCDAAAGLDQSTDSTPDSNSAE
FSKETSTVFPPATSGDEATPAAGVLTPLSPTEAETVLPDALGSTPASSDGPRLTQTPPSP
AGASASTGPKVGLTTALENFESSSSAASSPPAPTAATSKDVTTALRELLTTLIPASSDAV
RGVTRDDTTAGVTTNDPSAVTQQPAKTTYDSNDTDLCSGRPVSGVTTLRNGTMVVFRGHY
FWVLDKNKLPGAAQSITQTWGVPSPIDTVFTRCNCEGKTYIFKGNQYWRFENGAVDTGYP
KPVQSGFDGLQGHITAALSVPQYRKRRESVYFFKRGGLVQKYSYHFTPSTTCGTKPKINI
YTVRHRVSRQAAVSNLGPAINIRASWSGFPSTITAAVSVPNKRDPEGYKYYVFSRAQFYK
VGMKSERPALAAPATNTSAQNNLFKCP
Download sequence
Identical sequences H2RYC4
ENSTRUP00000005145 ENSTRUP00000005145 31033.ENSTRUP00000005145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]