SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2S150 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2S150
Domain Number 1 Region: 635-890
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-55
Family YWTD domain 0.00000406
Further Details:      
 
Domain Number 2 Region: 22-281
Classification Level Classification E-value
Superfamily YWTD domain 7.59e-54
Family YWTD domain 0.00000227
Further Details:      
 
Domain Number 3 Region: 334-572
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-52
Family YWTD domain 0.00000356
Further Details:      
 
Domain Number 4 Region: 938-1198
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-39
Family YWTD domain 0.0000424
Further Details:      
 
Domain Number 5 Region: 1328-1366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 6 Region: 893-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family EGF-type module 0.012
Further Details:      
 
Domain Number 7 Region: 1250-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000825
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 1290-1326
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 287-328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 10 Region: 592-637
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000995
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 11 Region: 1207-1259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000806
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2S150
Sequence length 1618
Comment (tr|H2S150|H2S150_TAKRU) Low-density lipoprotein receptor-related protein {ECO:0000256|PIRNR:PIRNR036314} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=lrp6 OC=Takifugu.
Sequence
MGVALRTLLLWSFCCLIGSGVPLLLYANRRDLRLVDAAHEKANATVVVGGLEDAAAVDYV
YSQGLIYWSDVSEEAIKRTVFNQSGAHTVQTVIPGLASPDGLACDWLGRKLYWTDSETNR
IEVAELDGSMRKILFWQELDQPRAIALDPERGFMYWTDWGEIPKIERAGMDGTNRSMIID
KEIYWPNGLTLDYGQQKLYWADAKHSFIHRCDLDGSSREVVVKGDLPHPFALTLYEDTLF
WTDWNTHSIHSCSKHTGGEQRVVHANIFSPMDIHVFSEERQNTRASSPCLLNNGGCSHLC
LLSPSSPSYQCACPTGVQLLADGRTCRDGATQVLLLARRTDLRRISLDTPDFTDIVLQVD
DIRHAIAIDYDPVDGYIYWTDDDVKAIRRSRLDGSDAQFVVTSQVNHPDGIAVDWIARNL
YWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERADLD
GMERVVMVNTSLGWPNGLALDYDERKIYWGDAKTDKIEVMHMDGTGRRVLVEDKLPHIFG
FTLLGDFIYWTDWQRRSIERVHKRTAEREFIIDQLPDLMGLKATSVRQAAGSNACAHSNG
GCSHLCLFKPQGVQCGCPIGLELIADMRTCIVPEAFLLFSRHTDIRRISLETNNNNVAIP
LTGVKEASALDFDVTDNRIYWTDITLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGK
NLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGYMYWTEWGGKPKIDRAA
MDGSGRITLVADVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGQDREVIADDLQHPFG
LTQYQDYIYWTDWSQRSIERANKTSGQNRTLIQGHLDYVMDILVFHSSRQGGWNACSSTN
GHCSHLCLAVPVSSFVCGCPAHFSLNEDNKTCSAPTSFLLFSQKTAINRMVIDEQQSPDI
ILPIHSLRNVRAIDYDPLDKQLYWIDSKQNVIRRAQEDGNQSVTVVSGLMGGPSQGIQLY
DLSIDIYSRFIYWTSEVTNVINVTRTDGSRVGVVLRGEQDKPRAIVVNPERGYMYFTNLL
ERSPKIERAALDGTEREVLFFSGLGKPVALAIDNEVGKLFWVDSDLRRIESSDLSGANRI
VIADSNILQPVGLTVFGKHLYWIDKQQQMIERIDKTTREGRTKVQARVPYLSDIHAVNEL
DMREYSKHPCTWDNGGCSHICIVKGDGTTRCSCPVHLVLLQDELSCGDPPTCSPEQFSCT
SGEVDCIPRAWRCDGFAECDDSSDEEDCPVCSKSEFQCDSRQCIDLSLRCNGEINCQDRS
DENKCEVRCPSDQFTCSNGQCVGKHKKCDHNMDCTDNSDEFGCYPTEEPPPPPNSTIGSI
VGVVMTLFVVGAAYFVCQRVLCPQMKDDGETVTNDFVVHGPSSVPLGYVPHQSSLTSSLP
GMSRGKSVIGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATVRSQ
YTVELGYSSNSPSTHRSYSYRPYTYRHFAPPTTPCSTDVCDSDYTPGRRAPVKSSATVKG
YTSDLNYDSEPFPPPPTPRSQYLSAEENCESCPPSPYTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences H2S150
ENSTRUP00000006121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]