SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2SEH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SEH0
Domain Number 1 Region: 792-941
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.81e-39
Family Regulator of G-protein signaling, RGS 0.0000792
Further Details:      
 
Domain Number 2 Region: 1130-1231
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 282-423
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-21
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 28-113
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-20
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 5 Region: 1076-1144
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000127
Family Ras-binding domain, RBD 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2SEH0
Sequence length 1445
Comment (tr|H2SEH0|H2SEH0_TAKRU) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSTRUP00000010801} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MFRQLETSSRRRPCGGNVHQHPPPPACHQQGRIRAVEVARGRTGYGFTLSGQSPCVLSCI
LKGSPADYVGLHSGDCILSVNDINVSKASHEDVVKLIGRCSGVLKLVIAEGERAASYLDS
CSSEEELDPFYDNGVNNNNNSRSGGGGRGAWYKPKLDPKQLGIDRAEKVVAELQSGGIFN
MIFENSSHSSSSSDKDRPGISATSKPRPPSEPDFTPYRKASRSQSNPNLLSEEEMAQVLN
DDSVFLDADFHHLHLHQREEQDVDVGDGGDLMLESGEGILTVGMIVGYLGSIELASTGTS
LENDSLQAIRCSMRRLRAEQKIHSLVLMKVMHDSVRLCSDRGQVLATYPAEKLAFSACCP
DDRRFFGLVTMQATDDLDDGAFGRGREEEGSLRTSCHVFIVDPELCLHQVHSGVSRRFGF
ECTPDPDTGGCLEFPPSSQPLLQFVSVLYRDMGDSIEGVRARAFNDPDNDAQQNHSTSSN
SDSGIGNFLQEEKSNRVLLVDLGGPPNHSSGPRHWESPPSSQQAWSPTLGAAASHPPPPP
LRNGQYRHESHVADLPHPLPLTHSDVPGRHSRGVHPHNYSPGKRGGAVGGGLGLGVDQQR
WLPVHVLRDWRQQHHRSHFQGLSSDQESYAESTDGWSSANCSTLPPPMNKIPADRYRAPV
APGDHLAAPGESQPPPPSHLHAHGHRLAAQKDEWAKKLFGAGDRGRTGAERGEREKKRGN
AKEGEKKGGRFRGLTMGFPPLPQRSSARRSFGRSKRLSLARSLDDLESAAVSDGELNSVE
LQGCSSDNSLNSNASLPSVQSHRRHTERRVASWAVSFERLLQDPVGIRYFSEFLKKEFSE
ENILFWQACEFFSHVPENDKKQLSQRAREIYNSFLSSKATTPVNIDSQAQLADDILNAPR
PDMFKEQQLQIYNLMKFDSYTRFLKSLLYQECMLAEVESRPLPDPYHIPSSPTSKHSTTG
SDRSNLSTPKKSQEDKKSKSGRSLNDDGRDDSGDRRKGMFFSWSRNRSFGKGPKKRELTD
FNYNFSAINGRRESQGSLSSGASLELGTSGSGKTEGDASRGAASAERGGGSAPLRQCNIS
LPDGSCCSVPLRAGVTIRDLLTGLCEKLCINLAAVDLFLIGGEKPLVLDQDCMTLCSRDL
RLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLSDLVARISGELEPLDL
GLPISNLDGLRVILDAAEHAPSKDRQKVVPSTSRSQATTGEDSPSGKAGSARPNEAPEKR
KQKKINIDEAEEFFDLISKAQSNRADDQRGLLNKSHLQLPDFLRLSPIANSNNGSFPGGG
RRGNDRGGGCGGHLLSASHQSQSLDSALGGDAMGGRKVRPPAPPFPSTLSPVRPSPAGQH
QPLQDPFRGESVQMPEEDALSDLTLVGEGDINSPSLNYVSPSALQCKRRPQQHAGGRPSS
GTSPV
Download sequence
Identical sequences H2SEH0
ENSTRUP00000010801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]