SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2SEH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2SEH2
Domain Number 1 Region: 772-921
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 9.94e-39
Family Regulator of G-protein signaling, RGS 0.0000792
Further Details:      
 
Domain Number 2 Region: 1095-1193
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.1e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 262-403
Classification Level Classification E-value
Superfamily PH domain-like 1e-20
Family Phosphotyrosine-binding domain (PTB) 0.01
Further Details:      
 
Domain Number 4 Region: 28-112
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-20
Family PDZ domain 0.0089
Further Details:      
 
Domain Number 5 Region: 1041-1109
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000127
Family Ras-binding domain, RBD 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2SEH2
Sequence length 1456
Comment (tr|H2SEH2|H2SEH2_TAKRU) Regulator of G protein signaling 12b {ECO:0000313|Ensembl:ENSTRUP00000010803} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
MFRQLETSSRRRPCGGNVHQHPPPPACHQQGRIRAVEVARGRTGYGFTLSGQSPCVLSCI
LKGSPADYVGLHSGDCILSVNDINVSKASHEDVVKLIGRCSGVLKLVIAEGDNGVNNNNN
SRSGGGGRGAWYKPKLDPKQLGIDRAEKVVAELQSGGIFNMIFENSSHSSSSSDKDRPGI
SATSKPRPPSEPDFTPYRKASRSQSNPNLLSEEEMAQVLNDDSVFLDADFHHLHLHQREE
QDVDVGDGGDLMLESGEGILTVGMIVGYLGSIELASTGTSLENDSLQAIRCSMRRLRAEQ
KIHSLVLMKVMHDSVRLCSDRGQVLATYPAEKLAFSACCPDDRRFFGLVTMQATDDLDDG
AFGRGREEEGSLRTSCHVFIVDPELCLHQVHSGVSRRFGFECTPDPDTGGCLEFPPSSQP
LLQFVSVLYRDMGDSIEGVRARAFNDPDNDAQQNHSTSSNSDSGIGNFLQEEKSNRVLLV
DLGGPPNHSSGPRHWESPPSSQQAWSPTLGAAASHPPPPPLRNGQYRHESHVADLPHPLP
LTHSDVPGRHSRGVHPHNYSPGKRGGAVGGGLGLGVDQQRWLPVHVLRDWRQQHHRSHFQ
GLSSDQESYAESTDGWSSANCSTLPPPMNKIPADRYRAPVAPGDHLAAPGESQPPPPSHL
HAHGHRLAAQKDEWAKKLFGAGDRGRTGAERGEREKKRGNAKEGEKKGGRFRGLTMGFPP
LPQRSSARRSFGRSKRLSLARSLDDLESAAVSDGELNSVELQGCSSDNSLNSNASLPSVQ
SHRRHTERRVASWAVSFERLLQDPVGIRYFSEFLKKEFSEENILFWQACEFFSHVPENDK
KQLSQRAREIYNSFLSSKATTPVNIDSQAQLADDILNAPRPDMFKEQQLQIYNLMKFDSY
TRFLKSLLYQECMLAEVESRPLPDPYHIPSSPTSKHSTTGSDRSNLSTPKKEDKKSKSGR
SLNDDGRDDSGDRRKGMFFSWSRNRSFGKGPKKRELTDFNYNFSAINGRRESQGSLSSGA
SLELGTSGSAERGGGSAPLRQCNISLPDGSCCSVPLRAGVTIRDLLTGLCEKLCINLAAV
DLFLIGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRP
VVAKYGLHLSDLVARISGELEPLDLGLPISNLDGLRVILDAAEHAPSKDCADRQKVVPST
SRSQATTGEDSPSGKAGSARPNEENGKAGPGSDTSRQAFPNHSVSLHKAPEKRKQKKINI
DEAEEFFDLISKAQSNRADDQRGLLNKSHLQLPDFLRLSPIASDRAAPPPYDSEPGCSTP
HSRNSNNGSFPGGGRRGNDRGGGCGGHLLSASHQSQSLDSALGGDAMGGRKVRPPAPPFP
STLSPVRPSPAGQHQPLQDPFRGESVQMPEEDALSDLTLVGEGDINSPSLNYVSPSALQC
KRRPQQHAGGRPSSGT
Download sequence
Identical sequences H2SEH2
31033.ENSTRUP00000010803 ENSTRUP00000010803 ENSTRUP00000010803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]