SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2TKC1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2TKC1
Domain Number 1 Region: 663-787
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.51e-39
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 
Domain Number 2 Region: 974-1072
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.24e-28
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 20-103
Classification Level Classification E-value
Superfamily PDZ domain-like 6.84e-19
Family PDZ domain 0.0093
Further Details:      
 
Domain Number 4 Region: 920-988
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000388
Family UBX domain 0.043
Further Details:      
 
Domain Number 5 Region: 202-316
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000584
Family Phosphotyrosine-binding domain (PTB) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2TKC1
Sequence length 1278
Comment (tr|H2TKC1|H2TKC1_TAKRU) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSTRUP00000025125} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101063955 OC=Takifugu.
Sequence
MRIQGQPEGARRRLDLGGDGELRSVEIIRGRAGYGFTISGQRPCLLSGIQEGSPADVVGL
KQGDQIMAINGTDVSVALHETVVQLIGSCKGPLRIVVHTEGRKMKNPILNDAKFGIVQTN
EVYQKTGILRTISDDSNNSSFNLSHAVSLKPRPVSEPDISQWSQHWNPFLEKPKEETRRV
GDADNVFTEGEEGNPDWTMLNITLVVGYLSSTELILNTSGSEDDCSKAILERIRQLGTEQ
TTHTLVMMKIMYDCVRLCDDAGAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIVNGRLP
EDGPLRASCHVFFIDPELGNHEDHVGIAGRFGFECTPDPDTLGCLEFPQTPPDVLHFVTV
LYSEMGEAVERLRAKLDAEAQQHAKENDSTGKQGSSSSNGDSGFGNASPPEERAERDFPA
AIQNHPGAHLPSCPWDYPTSEDVIRINLSKNVRKLNPRNSCSLHSLSESLPGPDSLANLY
GGPPPRLEFQFKPPPPPLPLDKKANFFSEPLRSSQRWFSKPKWQKGQRSKPEPGMVPNHS
VSLNNLPPPMSQIPSDRYQTGEAMMLPPREEWTRQFLDQRDKHSKEFKHGSRFWGMGGNR
ASKRRPAKRLSLARSLDDLESAASSDGDYSGVQLQGCCSQSSLNSNGSLPGGGGHRGVPE
QRVASWSTCFERLLQDPVGVRYFTEFLKKEFSEENILFWQACEYFSQVPATDKKQLSQRA
GEIYNSFLSSKATMPVNIDSQAQLADDVLTSPRPDMFKTQQLQIFNLMKFDSYSRFLKSS
LYQECMHAELDGRPLPDPYQIPCSPAPSKHSASSDRSTLSTPKKEARKQRSGRSLNEDTR
EESADKKRGIFFSWSRNRSFGKGPKKKDIGDINLDYWGSNGRRESQGSLSSGASLEMATS
CKAEGDNRHSVGAWERSPRQCSVMLPDGSCSSITLRPGSFIREVLQDLCQSIAVNIAAVD
LFLVGGEKPLVLDQDCMTLCSRDLRLEKRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPV
VAKYGLHLGDLVAKISGETEPLDLGAPISSLDGLRVVLERGDPVSGKDKSKSSSLKGHPP
TRSFSATSALLLLHLQADDRSAPKDFSVRASGPDSALPGEKRKQKKINIDEAEEFFELLS
RAQSARANDQRGLLSKEDLVLPDFLRLSPPGLASSTPDSLKQARENGAPSRGSLASALRS
ESLDSSLRSSANGHSAARRYLLPPPRQPTFGSHLSPISRPSESRTSLRTVEEDAHADLTL
VGEGDINSPNSTLLPPSP
Download sequence
Identical sequences H2TKC1
ENSTRUP00000025125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]