SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2V2L7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2V2L7
Domain Number 1 Region: 24-257
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.18e-77
Family Calponin-homology domain, CH-domain 0.0000824
Further Details:      
 
Domain Number 2 Region: 1329-1445
Classification Level Classification E-value
Superfamily E set domains 6.37e-37
Family Filamin repeat (rod domain) 0.0000133
Further Details:      
 
Domain Number 3 Region: 1519-1637
Classification Level Classification E-value
Superfamily E set domains 6.14e-33
Family Filamin repeat (rod domain) 0.00000805
Further Details:      
 
Domain Number 4 Region: 451-568
Classification Level Classification E-value
Superfamily E set domains 2.67e-32
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 5 Region: 1061-1152
Classification Level Classification E-value
Superfamily E set domains 4.07e-31
Family Filamin repeat (rod domain) 0.0000108
Further Details:      
 
Domain Number 6 Region: 1442-1551
Classification Level Classification E-value
Superfamily E set domains 3.01e-30
Family Filamin repeat (rod domain) 0.0000293
Further Details:      
 
Domain Number 7 Region: 1849-1945
Classification Level Classification E-value
Superfamily E set domains 6.67e-30
Family Filamin repeat (rod domain) 0.0000101
Further Details:      
 
Domain Number 8 Region: 1240-1350
Classification Level Classification E-value
Superfamily E set domains 1.27e-28
Family Filamin repeat (rod domain) 0.0000246
Further Details:      
 
Domain Number 9 Region: 667-762
Classification Level Classification E-value
Superfamily E set domains 1.93e-27
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 10 Region: 1155-1263
Classification Level Classification E-value
Superfamily E set domains 2.67e-27
Family Filamin repeat (rod domain) 0.0000921
Further Details:      
 
Domain Number 11 Region: 2038-2131
Classification Level Classification E-value
Superfamily E set domains 4.85e-27
Family Filamin repeat (rod domain) 0.0000395
Further Details:      
 
Domain Number 12 Region: 857-967
Classification Level Classification E-value
Superfamily E set domains 5.8e-27
Family Filamin repeat (rod domain) 0.00076
Further Details:      
 
Domain Number 13 Region: 748-868
Classification Level Classification E-value
Superfamily E set domains 3.54e-26
Family Filamin repeat (rod domain) 0.00075
Further Details:      
 
Domain Number 14 Region: 2313-2403
Classification Level Classification E-value
Superfamily E set domains 8.01e-26
Family Filamin repeat (rod domain) 0.00000824
Further Details:      
 
Domain Number 15 Region: 275-369
Classification Level Classification E-value
Superfamily E set domains 1.2e-25
Family Filamin repeat (rod domain) 0.00074
Further Details:      
 
Domain Number 16 Region: 373-473
Classification Level Classification E-value
Superfamily E set domains 1.93e-25
Family Filamin repeat (rod domain) 0.00096
Further Details:      
 
Domain Number 17 Region: 559-661
Classification Level Classification E-value
Superfamily E set domains 2.87e-25
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 18 Region: 2504-2595
Classification Level Classification E-value
Superfamily E set domains 2.47e-24
Family Filamin repeat (rod domain) 0.0000084
Further Details:      
 
Domain Number 19 Region: 2639-2728
Classification Level Classification E-value
Superfamily E set domains 2e-23
Family Filamin repeat (rod domain) 0.0000122
Further Details:      
 
Domain Number 20 Region: 2246-2327
Classification Level Classification E-value
Superfamily E set domains 5.67e-22
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 21 Region: 1623-1733
Classification Level Classification E-value
Superfamily E set domains 6.67e-22
Family Filamin repeat (rod domain) 0.0000931
Further Details:      
 
Domain Number 22 Region: 955-1058
Classification Level Classification E-value
Superfamily E set domains 9.34e-22
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 23 Region: 2411-2500
Classification Level Classification E-value
Superfamily E set domains 2.8e-21
Family Filamin repeat (rod domain) 0.0000151
Further Details:      
 
Domain Number 24 Region: 1954-2034
Classification Level Classification E-value
Superfamily E set domains 1.2e-16
Family Filamin repeat (rod domain) 0.0000767
Further Details:      
 
Domain Number 25 Region: 1782-1866
Classification Level Classification E-value
Superfamily E set domains 3.74e-16
Family Filamin repeat (rod domain) 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2V2L7
Sequence length 2730
Comment (tr|H2V2L7|H2V2L7_TAKRU) Filamin C, gamma a (actin binding protein 280) {ECO:0000313|Ensembl:ENSTRUP00000043448} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence
EQQPPQYYQATDFGEEEDEEMPATEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKTITDL
QREFTDGLKLISLLEVLSQKKMYRKYHTRPNFRQMKLENVSVALEFLERERIKLVSIDSK
AIVDGNLKLILGLIWTLILHYSISMPMWDDEDDEETKKLTPKQRLLGWIQNKVPQLPINN
FNRDWQDGKALGALVDNCAPGLCPDWADWDPNEPVQNAREAMQQADDWLGVPQVIAPEEI
VDPDVDEHSVMTYLSQFPKAKLKPGAPLRPKQLFPNKVKAYGPGIEPHGNKVLQPAVFTV
DTAEAGSGEVLVYVEDPEGHTEEAKVKPNKDKSRTYTVTYVPKVEGVHKVKVLFAGQAID
KSPYTVNVAKDMGDPSKVHARGPGLDPVGNVANKPTYFDIYTAGAGNGDISVVIIDPQGK
KDTVELILENKGDSVFRCTYRPVLEGPHTIHVLFAEQEIPKSPYTVNIAEAVNPNACRAT
GRGLQPKGVRVKEVADFKVFTKGAGSGELKVSVKGPTGAEEQVKVQDAGNGVYNCEYYPL
KPGKYTVSITWGGHPIPRSPFEVEVGGEAGFQKVRAWGPGLKTGMVGKSADFVVEAIGTD
VGTLGFSIEGPSQAKIECDDKGDGSCDVHYWPTEPGDYAVHVICDDEDIKDSPFIAHILP
AANDTFPEKVKAYGPGLKPTGVTVNKPTEFTIDARMAGKGQLKIYAQDAEGCTIDIKITD
KRDGTYLCVYTPVKPIKHTIIITWGEVNVPNSPFRVLVGEGSHPDKVKVYGPGVEKTGLK
ANEPTYFTVDCGEAGQALGDISIGIKCAPGVVGPGEADIDFDIIKNDNDTFTVKYTPPAP
GRYTIMVLFAEQEIPISPFKVKVDPSHDAGKVRAEGPGLNKTGVEVGTPTHFTIYTKGAG
KAKPEVHFAASRPGEAVRDFEIIDNHDYSYTVKYTALQQGNMSISVTHGGDPIPKSPFHI
TVAPPLDIGKVKVDGLDNKVEVGKDQEFTVNTKGAGGQGNVGVKMTSPSGRPIPCKLESD
KAKGIHSVKYIPPEEGHYKVDVSYDGNPVMGSPFGVEAVMPADPSKVRAFGPGLQGGIVG
KPAPFTIDTKGAGAGGLGLTVEGPCEAKIECQDNGDGSCSVYYLPTEPGEYAINILFADQ
HIPGSPFKAPVRMALDPSKVTASGPGLERAKAGEPATFTVDCTRAGEAELTIEIVSETGA
KAEVHIQKTAEGTFSVTYIPPFHGAHTITIKYGGHMIPHFPKVLQVDPSVDTSGVHVYGP
GVEPRGVLRDVTTHFIVDAHALKKAGGNHVKVHVINPSGTKTESYITDKGDGTYRVEYTA
FEDGIHLIEVLYDDVPVPKSPFRVSVVEGCDPSRVRAFGPGLEGGITNKANCFTVETRGA
GTGGLGLTIEGASEAKISCKDNKDGSCSVEYIPFTPGDYDVNITYGGHPIPGSPFRVPVK
DPVDPSKVKCSGPGLGTGVRAHVPQTFTVDCTQAGQAPLDVKLYGPTGTAEPVGVKNNGD
GTHTVHYTPAQDGPYAVAVKYAEQEVPHSPFKVMSQPGHDASKVRASGPGLDTKGVSASL
PVEFTIDARDAGEGLLTVQILDPEGKPKNATIQDNRDGTYTVSYVPDSTGPYTITIKYGG
DEIPYSPYRIQSLPTGDASKCLLTVSIGGHGVSNLQKLQTSEDTVITVDAKAAGKGKVTC
KVQTPQGMELDMDVVENRDGTFDIYYTAPEPGKYVITIRFGGQNIPKSPFHVVSIYPVAP
CMIVTILLSFSFMKPTVFSFFLATNEPVVPRDTVDPLFRPVNFLVPFTPHQGEITGEVRM
PSGKTARSHITDNKDGTITIKYQPTERGLHEMDIKYEGNHIPGSPLQFYVDAVNTGVVTA
YGPGLSYGMVNKAATFTVVTKNAGEGGLSLAVEGPSKAEITCKDNKDGTCLVSYLPTAPG
DYNIIVKFDNKHIPGSPFTAKITAEGDDTITRTSQLNVGTSTDVSLKITETDLSSLTASI
RAPSGNEEPCLLKKLPNRHLGISFTPKEVGEHEVSVRKNGIHVANSPFKIMVGQSEIGEA
SRVKAFGKGLVEAHTSEMAEFFVDTRNAGYGGLALSVEGPSKVDINCEDMEDRTCKVTYC
PTEPGNYNVNIKFAEKHIPGSPFTVKVTGEGRIRESITRKRQASSLASVGSTCGLNLKIP
GNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRAGETKREVRVEESTQVGGGGSPFR
DVFGDFLGRESLSSFAGITARPEVECGPQTMTAQVTSPGGKTVDADIVDGGNSTYSVRFI
PQEMGPHTVNVKYRGQHVPGSPFQFTVGPMGEGGAHKVRAGGPGLERGVAAAPSEFSIWT
REAGAGGLSIAVEGPSKAEISFEDRKDGSCGVSYIVKEPGDYEVSIKFNNEHIPDSPFIV
PIATLSDEARRLTVTSLQEKDLKVNQEASFMVQRNGARGVVDAKVHTPSGSSEECYVTEL
DSDKNAIRFIPRENGVHSIDVKFNGCHIPGSPFNVRVGDPGLIGDPGMVTAHGPGLQGGT
TGVPSEFVVKTCNAGSGTLSVNIDGPSKVKLDCRECPEGFKITYTPMAPGNYLITIKYGG
PQHIVGSPFKAKITGARLSGGHSLHETSSVLVETVTKTTKVGGAYSSSSSTSATKLTSDA
SKVVCRGTGLSKALVGQKNNFTVDCSKAGTNMLMVGVHGPHAPCEEVYVKHMGNKLYNVT
YAIKDKGSYQIIVKWGDDNVPGSPYKVVAP
Download sequence
Identical sequences H2V2L7
31033.ENSTRUP00000043448 ENSTRUP00000043448 ENSTRUP00000043448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]