SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2WQ30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2WQ30
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.42e-62
Family GDI-like N domain 0.00000000803
Further Details:      
 
Domain Number 2 Region: 390-435
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000919
Family GDI-like N domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2WQ30
Sequence length 444
Comment (tr|H2WQ30|H2WQ30_CAEJA) Rab GDP dissociation inhibitor {ECO:0000256|RuleBase:RU363124} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MDEEYDAIVLGTGLKECIISGMLSVSGKKVLHIDRNNYYGGESASLTPLEQLYEKFYGAN
AKPQPEMGRGRDWNVDLIPKFLMANGPLVKLLIHTGVTRYLEFKSIESSFVVKGGKIYKV
PADEMEALATSLMGMFEKRRFKKFLVWVQQFDENNQDTWNGLDPHNNTMQQVYEKFGLDE
NTADFTGHALALYRDDEHKTQPFAPAVEKIRLYSDSLARYGKSPYLYPLYGLGELPQGFA
RLSAIYGGTYMLDKPVDEIVIEGGKAIGVKCGEEIVRGKQIYCDPSYAKDRVKKTGQVVR
AICLLNHPIPNTNDAQSCQIIIPQKQVGRHYDIYISCCSNTNMVTPKGWYLAMVSTTVET
ANPEAEVLPGLQLLGTIAEKFIQISDVYEPTDMGTESQIFISQSYDATTHFETTCKDVLN
MFERGTTKEFDFTNITHLSLNDQD
Download sequence
Identical sequences H2WQ30
CJA18841 281687.CJA18841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]