SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2YI23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2YI23
Domain Number 1 Region: 1-120
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.88e-21
Family DNA replication factor Cdt1 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2YI23
Sequence length 120
Comment (tr|H2YI23|H2YI23_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000004972} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MFHSADTVVSMMFNRQQTTTWIKLQQAVKDMIKKKFELRDLGRIKHVFPGAYVYRQERGI
PTYDDRIKSTDYQLTIEPILTEEECDRASDEPRKLDSGLLVMRRHHFHLQLLSMVKHHHK
Download sequence
Identical sequences H2YI23
ENSCSAVP00000004972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]