SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2YMX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2YMX2
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.68e-33
Family Forkhead DNA-binding domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2YMX2
Sequence length 116
Comment (tr|H2YMX2|H2YMX2_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000006674} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
QPQQPKVFPKPVYSYSCLIAMSLRHSKMGCLPVSDIYSYMMENFPYFKTAPDGWKNSVRH
NLSLNKCFEKVEKASGTQRKGCLWAMNPAKIGKMEEEVQKWKRKDPEAIRTEHCSS
Download sequence
Identical sequences H2YMX2
ENSCSAVP00000006674 ENSCSAVP00000006674 51511.ENSCSAVP00000006674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]