SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H2YTC0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2YTC0
Domain Number 1 Region: 5-221
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.35e-63
Family D-ribulose-5-phosphate 3-epimerase 0.00000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H2YTC0
Sequence length 231
Comment (tr|H2YTC0|H2YTC0_CIOSA) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MCAYQCKIGPSILNSDLARLGDECKRMLECGADYLHLDVMDGHFVPNITFGHPVVQCIRK
SIGDSPVCEVHMMVSKPEQWVKAMAESGANIYTFHLEAAENAEQLIKDIRMEGMKAGCAI
KPATPVSKLLDLLYTQMADVALVMTVEPGFGGQSFMRPMMEKVRELRKVHPTLDIGVDGG
VGPNCIHHCAEAGANMIVSGSAIMRSNDPRKVITDLRNVVQEVIQQTTLER
Download sequence
Identical sequences H2YTC0
ENSCSAVP00000008580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]