SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2ZM90 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZM90
Domain Number 1 Region: 51-529
Classification Level Classification E-value
Superfamily PLP-dependent transferases 5.21e-117
Family Pyridoxal-dependent decarboxylase 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H2ZM90
Sequence length 530
Comment (tr|H2ZM90|H2ZM90_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000018706} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
MSKLYFATTQRLAKSRLYFSVNNIEKSVSPFCQTISRKMATNPDVTKPASPEEQDKFLND
VFQMCMQRAVQASRDRNTPLVNFKKPEELKKLLNFELQGTGESHTNLLALCDKVFDYSVL
SGHPYFFNQQIGGLDSYGYAGNLITDALTTNGHTYEIAPVFTMTEFAVLEHMLKLVGFHN
GEGTFCPGGSYCGMLAMNVARLQKYPDSKSKGLYGLPRLVTFCSEQAHYSAEKNSTLLGL
GTDNCWKVKCDNRGKMIPEEFEKRVIQCKNEGAVPIMVVATAGTTVLGAFDPFHEIADIC
SRHDIWMHIDAAWGGAALLSQKYKHLCDGVNRADSLAWNPHKMMMAPIQCSVLLLKEKDL
LNRCHSINVPYLFQNDKPYDTKYDLSRNLVQCGRSCDALKLWLMWKAKGDSGFESQVNQA
LAKAEYLTEQIRKRSDFRLVIPEPEYTNVSFWYIPPSMAGKEENADYFKQLASIVPTIKL
RMQLSGKLLVGYSPVGDYPTFFRMIVLNDKVNFEDMDHVLNEIERNGRDL
Download sequence
Identical sequences H2ZM90
51511.ENSCSAVP00000018706 ENSCSAVP00000018706 ENSCSAVP00000018706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]