SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H2ZND7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H2ZND7
Domain Number 1 Region: 20-121
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0000157
Family Recombination protein RecR 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H2ZND7
Sequence length 240
Comment (tr|H2ZND7|H2ZND7_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000019103} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence
METGELSEEMQDPTTSINIIYDRCGLCGNIGKALACLYCMQSDSKRFLVLTTPTKSLRSL
NFQGKYMYLSRDIQDKIQNVHQVLSQHEQLIISSSNSVEELAIQASLKFKIAHCSQNVAR
LKKLLLARKLEMKQQQNLLLDNKRVIMTLRKKIGKVSQKKSKMKEYIRNRQDSILAIRKK
EQILREDLQIHRLKHISMLVQYIFPIEECNKSDLPNMVPQVHDDHGSEVDRETALLQEEL
Download sequence
Identical sequences H2ZND7
51511.ENSCSAVP00000019103 ENSCSAVP00000019103 ENSCSAVP00000019103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]