SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3BNL6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BNL6
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.63e-28
Family Pyridoxal-dependent decarboxylase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3BNL6
Sequence length 271
Comment (tr|H3BNL6|H3BNL6_HUMAN) Pyridoxal-dependent decarboxylase domain-containing protein 1 {ECO:0000313|Ensembl:ENSP00000454910} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PDXDC1 OC=Catarrhini; Hominidae; Homo.
Sequence
MGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVSILQLVQNLMHGDEDE
EPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSDTTLWLCRIFRYENGC
AYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSAAARPGLGQYLCNQDV
AFLEKLIKDDIERGRLPLLLVANAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLA
LGYVSSSVLAAAKCDSMTMTPGPWLGLPAVP
Download sequence
Identical sequences H3BNL6
ENSP00000454910 ENSP00000454910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]