SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3BU54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3BU54
Domain Number 1 Region: 11-176
Classification Level Classification E-value
Superfamily PLP-dependent transferases 7.82e-21
Family AAT-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3BU54
Sequence length 177
Comment (tr|H3BU54|H3BU54_HUMAN) Alanine aminotransferase 2 {ECO:0000313|Ensembl:ENSP00000457475} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=GPT2 OC=Catarrhini; Hominidae; Homo.
Sequence
MQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRI
LQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKIL
VSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEA
Download sequence
Identical sequences H3BU54
ENSP00000457475 ENSP00000457475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]