SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CKM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CKM2
Domain Number 1 Region: 636-768
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.22e-38
Family Regulator of G-protein signaling, RGS 0.00012
Further Details:      
 
Domain Number 2 Region: 947-1048
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-29
Family Ras-binding domain, RBD 0.001
Further Details:      
 
Domain Number 3 Region: 2-83
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-18
Family PDZ domain 0.0092
Further Details:      
 
Domain Number 4 Region: 893-961
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000121
Family UBX domain 0.05
Further Details:      
 
Domain Number 5 Region: 181-299
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000258
Family Phosphotyrosine-binding domain (PTB) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CKM2
Sequence length 1258
Comment (tr|H3CKM2|H3CKM2_TETNG) Regulator of G protein signaling 12a {ECO:0000313|Ensembl:ENSTNIP00000008801} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
LRSVEIIRGRAGYGFTISGQRPCLLSGIQEGSPADVVGLKQGDQIMAINGTDVSVTLHET
VVQLIGSCKGPLQMVVQTEGRKMKNPILNDAKFGIVQKNEIYQKAGILRTISDDSNNSSF
NSTHAVPLKQRPASEPDVSQWCQHWNPFVDKPTGKTCQVGDGDAVFTEGEGGNPDWNMLN
ITLVVGYLSSTELILNTSGSEDDCSRAILERIRQLGTEQNTHTLVMMKIMYDCVRLCDDA
GAVLAAFPAENLVLGAVCAEDPRFFCLVTTAHIVNGRVPENGPLRSSCHVFFIDPLGNHV
DHVGIAGRFGFECTPDPDSLGCLEFPQTPLDVLHFVTVLYSEMGEAVERLRSRFDAEAQL
HAKGNDSTGKQGSSSSNGDSGFGNASPPEERAERDFPAAIQKHSGAHLPSCPWDYPTTED
LIQLNLFKNGKKLNPRNSSSLHSLSESLPGPDSLASFYGGPPPRREFQFKPPPPPLPLDK
KPNLFVDPLRSSQRWFSKPKWQKVQRSNPEPGVVPNHSASLNNLPPPRCQIPSNRSQSGE
VKMLPPREEWTKHFLEQRDRQRKDFKNGSRFWGMGGIRASKRRSAKRLSLARSLDDLESA
ASSDGDYSGVQLQGCCSQSSLNSNGSLPGGGGHRGVPEQRVTSWSTCFEQLLQDPVGVRY
FTEFLKKEFSEENILFWQACEYFSHVPATDKKQLSQRAGEIYNSFLSSKATMPVNIDSQA
QLADDVLTSPRPDMFKTQQLQIFNLMKFDSYSRFLKSSLYQECVHAEQDGRSLPDPYQIP
CSPAPSKHSASSDRSTLSTPKKEARKQRSGRSLNEDAREESADKKRGIFFSWSRNRSFGK
GPKKKDIGDINLDYWGSNGRRESQGSLSSGTSLEMATSCKTESVGPWERPPRQCSVMLPD
GSCSSITLRSGSLIREVLQDLCQNIGVNIAAVDLFLVGGEKPLVLDQDCMTLCSRDLRLE
KRTLFRLDLVPINRSVGLKAKPTKPVTEVLRPVVAKYGLHLGDLVAKISGETEPLDLGAP
ISSLDGLRVVLERADPVSGKVSTDKSKSSSLKGHPPTRSFSATVSAAKSTLLLLHLQADD
RAAAKDFSGRAGGPDSALPGEKRKQKKINIDEAEEFFELLSRAQSARANDQRGLLRKEDL
VLPDFLRLSPPGLACSTPDSLKQARENGAPRGDASPPASARRAWTPPSAPAPTLRNAAVP
PATSPPSHFGSHLSPISRPSESRTSLRTVEEDAHTDLTLVGEGDINSPNSTLLPPSPS
Download sequence
Identical sequences H3CKM2
99883.ENSTNIP00000008801 ENSTNIP00000008801 ENSTNIP00000008801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]