SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CLL5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CLL5
Domain Number 1 Region: 112-239
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-41
Family Calponin-homology domain, CH-domain 0.000000589
Further Details:      
 
Domain Number 2 Region: 4-82
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000628
Family Calmodulin-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CLL5
Sequence length 240
Comment (tr|H3CLL5|H3CLL5_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000009144} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAATTPMSPEEEEELREAFAKIDVDNNGFISKDELNQLFQAANLGLPGYRVREIIQELMI
SGDQLTFEQFTQMVGSLRSSEVAKTFRKAINKKEGICNVAGRSEQSGTQHSYSEEEKVAF
VNWINKALEKDGDCKHVLPMDPSSNDLFTAVGDGIVLCKMINLSVADTIDERTINKKKLT
PFTIQENLNLALNSASAIGCHVVNIGAEDLKEGRQHLVLGLLWQVIKIGLFADIELSKNE
Download sequence
Identical sequences H3CLL5
ENSTNIP00000009144 ENSTNIP00000009144 99883.ENSTNIP00000009144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]