SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CNQ7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CNQ7
Domain Number 1 Region: 168-260
Classification Level Classification E-value
Superfamily TAFH domain-like 3.14e-33
Family TAFH domain-like 0.00000727
Further Details:      
 
Domain Number 2 Region: 433-481
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000184
Family TBP-associated factors, TAFs 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CNQ7
Sequence length 644
Comment (tr|H3CNQ7|H3CNQ7_TETNG) TATA-box binding protein associated factor 4 {ECO:0000313|Ensembl:ENSTNIP00000009890} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN=TAF4 OC=Tetraodon.
Sequence
TVAAVQGGVRALTPQVLAPRLPLTSPGQPSVHNIQIPPGMVLIQSESGQLLLIPQQALAQ
MQAQAQGGVAARTATPTNASPGQVSFSQATGNTVVSKPVAPSTIIHPGCAAPTSLPVTTT
LHRPPVLQSSAGASGTVPRTVNKTAGTTVTTIAMSKVSPASDTTCIYAHETIENVKKCKN
FLSTLMKLASTGKQSPETAALVRELVKDLLDGKLEAEEFTSRLYKELNSSPQPYLVPFLM
RSLPALRQLTPDSTAFIQQSQLPQPASAPVTSASAISSTVVLSSPAPRLPVPVSRPQFQP
GVTKPGQSTSLVLQPQQQRAVLGPQVTLATTPMVTLRNPAPSHIVLGQQRVQLKDLQPGS
VRQPGSKQASAPALTPSQRNQLKEAGGTFKDDDDINDVASMAGVNLSEESANILATNSEL
VGVVTRSCKDEAFLSASLLQRRMLEIGRRFGVTDLGAEVVKYVSHAAQQRLQSLLEKVSL
VAQQRHISFKEDERYEQDGDVRAQLKFFEQLDQLEKQRKEEQEREILLKAAKSRSRQEDP
EQLRLKQKAKEMQQQELAQLRQREANLTALAAIGPRKKRKFLDSPSSSSAEGSGPGPCLS
SSAVSGSRPVRQRITRVNLRDLLFCLENERFTSRSHFLYKSFLK
Download sequence
Identical sequences H3CNQ7
ENSTNIP00000009890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]