SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CNY5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CNY5
Domain Number 1 Region: 41-276
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.9e-88
Family Calponin-homology domain, CH-domain 0.00000104
Further Details:      
 
Domain Number 2 Region: 295-416
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-35
Family Spectrin repeat 0.000062
Further Details:      
 
Domain Number 3 Region: 1645-1800
Classification Level Classification E-value
Superfamily Spectrin repeat 7.68e-30
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 4 Region: 904-1059
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-29
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 5 Region: 1010-1166
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-29
Family Spectrin repeat 0.0000212
Further Details:      
 
Domain Number 6 Region: 602-729
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-27
Family Spectrin repeat 0.00035
Further Details:      
 
Domain Number 7 Region: 1858-2012
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-27
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 8 Region: 1539-1693
Classification Level Classification E-value
Superfamily Spectrin repeat 3.73e-26
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 9 Region: 694-810
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-24
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 10 Region: 1228-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-24
Family Spectrin repeat 0.00078
Further Details:      
 
Domain Number 11 Region: 425-528
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-23
Family Spectrin repeat 0.00031
Further Details:      
 
Domain Number 12 Region: 529-637
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 13 Region: 1384-1481
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-16
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 14 Region: 1994-2078
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000798
Family Spectrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3CNY5
Sequence length 2108
Comment (tr|H3CNY5|H3CNY5_TETNG) Spectrin beta chain {ECO:0000256|PIRNR:PIRNR002297} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
EVEMTSVAAEFEHMEIQQQFNDGVNNRWDADDWDNENSSARLFERSRIKALADEREAVQK
KTFTKWVNSHLSRVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVD
KALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQQIQDISVETEKKSAKDALL
LWCQMKTAGYSNVNIHNFTTSWRDGMAFNAIIHKHRPDLIDFDKLKKSNAHYNLQNAFNL
AEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAIET
EKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKG
NLEVLLFTIQSKMRANNQKVFTPREGKLISDINKAWERLERAEHERELALRTELIRQEKL
EQLARRFDRKAAMRETWLSENQRLVSQDNFGCDLQAVEAATKKHEAIETDIAAYEERVQA
VVAVAKELEAESYHDIKRVTARKDNVTRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYI
MDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVRNVNSNAQKFAMDVEG
YRPCDPQVIQDRVTHMDFCYQELSQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQI
LSSEDHGKDLTGALRLLSQHKALEDEMSGRAGHLQQTIRQGEELVANHHFGADKIKERIQ
DIQAQWAELERLSAVRKSRLQEACNKHQFQADADDIDTWMLDILRIVSSVDVGHDEFSTQ
ALVKKHKDVAEEMGSYRPVIDALHEQSRALPVDGADSEEVQNRLAGIEERYKEVVELTRL
RKQALQDALTLYKMFSEANACEAWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNN
QASRVAVVNQVARQLIHSGHPSEKEIKSQQDKLNTRWSQFRDLADQKKDALNSALGVQNY
HLECNETKSWIKEKTKVIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEAE
RLASEHPDQSQTIKGRLAEITHVWGEMKDTMKNREESLGEASKLQQFLRDLDDFQSWLSR
TQTAIASEDMPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQYMFL
RQRLQALDTGWNELHRMWENRQNLLSQSHSYQLFLRDTKQAEAFLNNQEYVLAHTEMPTT
LEAAEASIKKQEDFMTTMDANEEKIIGVVDAGRRLVADGNINSERIQEKVDSIDQRHKKT
RAAAVELLDRLKDNRDLQKFLQDCQELSLWIGEKMLTAQDMTYDEARNLHSKWLKHQAFM
AELQSNKEWLDKIDKDGQTLMLEKPDTEAMVQEKLAWLKSTWAELESTTQTKAKCLFDAN
KAELFTQSCADLDKWLGSLEAQLQSDEYGKDLTSVNILLKKQQILESQVEVRQKEVEELQ
NQSQVLSQEGKGSEEVDGQRVSVERKFHLLLEPLKKRRDNLMVSREIHQFNRDVEDEILW
VEERLPVAMSTDHGHNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREDGPTAQ
LIGQRLAELTSLWQRIGEEAEKRHERLSEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKA
KDEQSSVFMLKKHQILEQAVEDYADTVHQLSATSRGLVAAGHPESERIGMRQSQVDKLYA
GLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFR
EFARDTGTIGQERVDAVNRQADELINAGHSDAATIAEWKDGLNEAWADLLELIDTRTQIL
AASYELHQFYHDAKEILSRILDKHKKLPEELGRDQNTVETLQRMHTAFEHDIQALGTQVR
QLQEDATRLQAAYAGDKADDIQKREAEVLEAWKNLLEAVEGRRLKLVDTGDKFRFFSMVR
DLMLWMEDVIRLIEAQENPRDVSSVELLMNNHQGIKAEIDARNDSFTCCIELGKTLLARK
HYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDASVAESWLLGQEPYLS
SREVGQNADEVEKLIKRHEAFEKSAATWEERFSALERLTTMELLEVRRVQEEEEKKRQAP
PTEAQLTD
Download sequence
Identical sequences H3CNY5
99883.ENSTNIP00000009968 ENSTNIP00000009968 ENSTNIP00000009968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]