SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3CSG8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3CSG8
Domain Number 1 Region: 1079-1203
Classification Level Classification E-value
Superfamily Cadherin-like 9.91e-27
Family Cadherin 0.0023
Further Details:      
 
Domain Number 2 Region: 1518-1670
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.86e-26
Family Laminin G-like module 0.0053
Further Details:      
 
Domain Number 3 Region: 863-975
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-25
Family Cadherin 0.00034
Further Details:      
 
Domain Number 4 Region: 133-244
Classification Level Classification E-value
Superfamily Cadherin-like 9.22e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 5 Region: 757-870
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-24
Family Cadherin 0.00093
Further Details:      
 
Domain Number 6 Region: 574-661
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-23
Family Cadherin 0.00098
Further Details:      
 
Domain Number 7 Region: 664-755
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-20
Family Cadherin 0.0033
Further Details:      
 
Domain Number 8 Region: 971-1096
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-16
Family Cadherin 0.0019
Further Details:      
 
Domain Number 9 Region: 1362-1487
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000038
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 10 Region: 471-579
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000288
Family Cadherin 0.017
Further Details:      
 
Domain Number 11 Region: 12-105
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000393
Family Cadherin 0.004
Further Details:      
 
Domain Number 12 Region: 1749-1785
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000439
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  H3CSG8
Domain Number - Region: 1319-1343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0298
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3CSG8
Sequence length 1868
Comment (tr|H3CSG8|H3CSG8_TETNG) Uncharacterized protein {ECO:0000313|Ensembl:ENSTNIP00000011202} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
HSTFVSALQVQVLITDENDCVPEFLQSIYSVDGVPETVTTATSLLQGLIRLRSNPLPKLQ
GLEYVLNVTATDDNASGGPQPLFSTARVIVGVDDVNNNKPVFKEVSDHSFKANGLGPQDL
LAITQSLLFNKCQQYREQASVLENQPTGTFVLQVHAVDADEGANGKVKYGLMHRDSAMPA
FRIHPDTGAIVTAQRFDRERQREYSVTVTATDWAEEPLIGICQLTVQILDQNDNSPKFEN
LRYEKSKKKKPLVLQLECTYIICIACRLPERGHFVSSAWQLMMMTSARMQLSLTPCPRSS
LSTCRSTPSLDGSTSTSRYHSCQPHTHTLKDPPIPKAFEVPGKMSSLFSGLKLTLIIFLS
FSLSQRCIINYNLCLHWSLEKSYACSQTGLSPGKPADAVVAQSRHAVSEELIAITANHLT
SPSLCASATHLQPQKSAQRTYITRDIVATDGGNRSSSVELAVTITNVKNQPPQWEEENYS
VVIPENTARDTPIVTIKATSQLGDPRVTYNLEDGMVPETNMPVRFYLSPNREDGSASILV
SEPLDYETTSFFSLRVRAQNVAAVPLAAFTTVYVNITDVNDNVPFFTSSIYEASVTEGAQ
IGTSVLQVSAHDKDLGLNGQITYTLLSDSSGDHSLFRIDPELGIIYTEAVFDREARSSYL
LERLYEVGVDEDADVGLAVVTVSATDEDEAGANAKLRYQITSGNKGGVFDIEPEVGTIFV
AQPLDYEQQKRYKLLVLASDGRWEDYAAIVVTVVNKNDEAPVFSMNEYYGSVTEELDGSP
VFVLQVTATDPDKDADQGAIRYSIHGQGAESHFVINDITGEMYAQRTMDREERTVWRFVV
MATDEEGEGLTGFTDVIINVWDINDNAPTFTCAPDNCHSSIAENSPPGTLVVEMTAVDLD
DAAIGQNAILTYRITKNVRNTNKEDFFAIDSSTGTISVAAEGLDREFADTHRVVVEASDG
GGMTGTATVTIAVTDINDHAPKFLEDWCGAHVSENTDKDASVLELRAVDPDIGTYGQLTF
SVLAGDLDQRFYMMSNRERQMGILMLKEKLDFEKPAEQGFNLTIKVEDSDFSSIIHCLIQ
IDDENDNAPEFASSSHLLPPLPEDVPVGTSIIQVVATDTDSGLNGEILYSILPQSDPHGH
FAVSRAGLVAVARPLDRETVAGYELVVMATDGTPALTASVTVHLLLLDTNDNGPELETAY
APVMPLVNPHLEPWHKPANPTTKSQRYRKGGKCGTGEEKLHAVLAAHKRKLQSLLRVNVS
QVEVDECVHADCRASGGCFTQLSVSNSPSLLDSGALSLVSVKVTPVAVCGCAAREMTYRI
CASYPGNPCLNGGTCMDTKNGYRMKPGTKTTGCCCAGPLATLLPGDTEDYMAIELIGGTP
SLKMNHGSGTLVLQLNHNIGVANGRWHRLDVRSNSKEVHFTLDRCSSAVIMETEGVDSWV
MTEDRSSCEIRGVTPKRDNGCIRNLLVDSKLYDLGSPAEASNTVPGCTLIDGHCTDGEPR
PPCGLRGHCHSHWGSYSCLCQPGFTGPQCDRDWQAAPEFSFDGRSHIQFQLSGSLPARQT
RVQVGVRTRAAAGVILSLLSQEQNEYLRLEVIQGLLAVFYNLGDGDYNLTLPHQHLSDGE
WHELELDRYGREFTLRLDGGGGRREVTASRGQGQEIVVDPTTVMLGNSFPSGHNHSFLGS
DVWGLTLPRAAKYPSGRRKPSEKEAHADSLASGCLSVFVHENVDAGQLKCPPGHITRETT
QGKVCMYTLCASRPCRHGTCVAHSPSRYSCHCSEGYRGRHCEVTLAMFHNEDNNSLSLSS
MFAISICVMAFLVLMLGLFLYSCWRRHKGLKEGVYHVSAHHGEWEDIRENVLNYDEEGGG
EQDQVRPH
Download sequence
Identical sequences H3CSG8
ENSTNIP00000011202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]