SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3D8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3D8W1
Domain Number 1 Region: 5-215
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.9e-62
Family D-ribulose-5-phosphate 3-epimerase 0.00000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3D8W1
Sequence length 226
Comment (tr|H3D8W1|H3D8W1_TETNG) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MAYNAKIGPSILSSDLSCLGSECVRMMECGADYLHLDVMDGHFVPNITFGHPMVECLRKS
VGQDPFFDMHMMVSRPEQWVKPMAAAGANQYTFHLEATTNPGNLIKDIKESGMKVGLAIK
PGTTEELAPWANHIDMALVMTVEGFGGQKFMEDMMPKVSWLRSQFPSLDIEVDGGVGPDT
VHKCAEAGANMIVSGSAVIGSDDPRSVIALLRTAVAEAIQKRSLDR
Download sequence
Identical sequences H3D8W1
ENSTNIP00000016952 ENSTNIP00000016952 99883.ENSTNIP00000016952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]