SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3DCK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DCK9
Domain Number 1 Region: 1415-1647
Classification Level Classification E-value
Superfamily Plakin repeat 1.83e-76
Family Plakin repeat 0.0000000395
Further Details:      
 
Domain Number 2 Region: 1723-1763,1812-2007
Classification Level Classification E-value
Superfamily Plakin repeat 1.22e-68
Family Plakin repeat 0.000000144
Further Details:      
 
Domain Number 3 Region: 1176-1407
Classification Level Classification E-value
Superfamily Plakin repeat 1.23e-65
Family Plakin repeat 0.00000538
Further Details:      
 
Domain Number 4 Region: 656-771,798-825
Classification Level Classification E-value
Superfamily Spectrin repeat 6.62e-16
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 5 Region: 49-177
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000105
Family Spectrin repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 1667-1718
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000157
Family Plakin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  H3DCK9
Domain Number - Region: 499-573
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0202
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number - Region: 5-71
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0384
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number - Region: 170-257
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3DCK9
Sequence length 2064
Comment (tr|H3DCK9|H3DCK9_TETNG) Desmoplakin a {ECO:0000313|Ensembl:ENSTNIP00000018252} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MIEMAPWGEDSLSIEKQIMSHNRTHSSLQRSQEVDRARDELNSKGDRYNLSILEQEWDSL
QKMSHNRVSQLRELQSIIEEISRAIMWVNEREEEELVFDWGDKNIDQYIPRKQESYSGLM
RDLEEKEKELNKLKLKADGLLSNNHPASDKIQAYMDTLQTQWSWLLQITKCIHVHLKENA
AYSQFFKEANETYTKLQKEHESVRSKFTCNKNTPLENLVDLLKNLEKENERIMENKRQVQ
SLVNKSKTIVRLIPRNPEEKSSSPIIVQALCDFKQDQKGILKGNEGILKDNSQRSKWLVT
GPGGLDMMIPSVCLLIPPPNPLSIGLANKNEQYYEAIMSIWNQLYINIKSLISWQYCLKD
ISYISSLTVSMLSKMRPEEYRSIIKRLETHYQEFLRTSQGSEMFGEEDKKTIQGQFDTAQ
NHYDTLIIQLPTYLTNTLVLFLTITDVGEEEVKPDTKPPLSSSSTLSLTLLNSLQELRRR
LELAESGLTSHLHITLGENSVHECTVHIQRLQALHQELDSIHDDYLQVKERIKKKLDGLP
PDSEQAKFLQTELEIINKKLLLLQSLKQVYLQRLAALKSLLHNLLQAEDIVKVNEARLTE
KETSSLDLKELANYRSTLKQMKSDLDQKRDLLTALESDLAKAVHWNGQISESFHKCDIDL
SKYSELVGQLSDRWRRIQTQIDSRLWDLEKQEKQLDHYQQSSTSLEQWIDNARKRQDTLQ
IAKFTDIQTLMDHLNQQKALHTEIKGKKEKVEDMQKTADTCASSIKDYELQLASYSSGLE
TLLKIPIKRTMLQSPASVVRHEVAGLQSQYIELLTRSSDYYKFLGELLKNMEELKIRNTK
IEMLEEQLRLLKDETKDRDQKNKSLEDALARYKLELSQSKEQLFSLEEVKRTTVLQANAT
KESLDSTHNQLQDLNDQLTRIKYQLEEEKRKKRLAEERYNSQQEEYEAAVRRRQKELEEL
NWMKIDLEKSVKDKERELERMKLLLEEEATRRRNAESDISKTSMMAQESQSHYNELVLER
DSLLSKLKLLEQDKSRHQRLEDELTRIKVTLETEIRNKQRLQDEKNAIHKDLSHLKNQFE
LREREIRQCNSDKDKAGRDNLSLKNEIEKLVRELKTVEERYKSRLLISEKEASDLALKRD
ALEREIQRLRQRPANMSKQTQTNEKIPSVDPSKLLFDGVRRKVTAHQLCDCGVITKATLE
QLLTGRKTVDEVAVDIQLYLKGTGIIAGMVTRSHGKMPFTEAKNNNLLTPESALKLLEAQ
AATGYIVDPEFNERMSVDAACSRGIVDTEDRDTLVTAEAACTGFKDPYTGKVLSVGQACK
QGRINKDTAIRLLQAQESVGGILDPVLSVFLPKDQALDRTLIDEELYTALTKKPTCYLDP
ATGEKITYSDLRKICTVDLVSGLLLLSAPEKAMTVKGLRGNVPVKELVASGLLDETDSQK
LSSKEIEEKLKSYLYGSTCIAGIYDEVKDRIMPFYQAMKEGLLMRGTTLELLEAQAASGF
IVDPVNNVFLTVEEASKKGLIGHEFKNKLLSAEKAVTGYKDPETGKIISLFQAIEKDLVE
KGHGIRLLEAQIASGGIIDPKESHRIDVSVAYKRGYFDEEMNEILSYEGDDTKGFFDPNT
QENLTYLQLKERCITSPKTGLVLLPLKDKKKIQKSEESRSNVLRKRRVVIVDPDTGLEMS
VREAYHKELIDYDTFLDLSEQECEWEEITIKGSDGTTRLVVVDRKTGTQYDVKDCLERGI
VDQKSFDQYRAGTITLTQFADQITHKTSTTELTIAASNVEDMATCSSPTQLTPSSPTVRK
RFSSISITVSPPEMFDDHSPVAAIFDTETLEKITITEGLRRGIVDTLTAQRLLEAQACTG
GLINPSTSERLSLQDAVHQGIIDESMASKLKPAQKASAGFEDVKIKRKMSVAEAVKEAWL
PYEAGQRFLEFQYLTGGLIEPGSGQRISIEEAIRRGWLDGQGAQKLQDTRNHQKNLTCPK
TKLKISYKEAMDGCMVEESNGMKMLQASSVSSKGISSPYNVSNPGSRSGSRAGSLAGSRN
GSRRGSVDYSSTYTYSFSSSSTTY
Download sequence
Identical sequences H3DCK9
ENSTNIP00000018252 ENSTNIP00000018252 99883.ENSTNIP00000018252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]