SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3DL89 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3DL89
Domain Number 1 Region: 268-405,435-501
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.98e-41
Family Hemopexin-like domain 0.00096
Further Details:      
 
Domain Number 2 Region: 64-105
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000157
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 23-62
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000112
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3DL89
Sequence length 501
Comment (tr|H3DL89|H3DL89_TETNG) Proteoglycan 4b {ECO:0000313|Ensembl:ENSTNIP00000021287} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence
MMSSTVTLAAVFLVCTLTLSTGQSSCKGRCGTDYYRGYMCQCDYTCLSYDECCEDYESQC
TTKNSCKGRCGEGFRRGRRCSCDPDCQKFKQCCSDFQTYCDAAEHRFSKTHRSPAEPADG
VNDQLMPLVSPAVDPDDLSDGESAVGVTELETAEADAHGTTPASSDGPPRTQTAPSSAVA
SASTVGSTAALEDSEWTGSSASSTLQPSAAASKDVATGPLLQELLTTLLPAALGVTGDDT
TAGATTNDPSAVTQKPGKTTSKDDSNDRDLCSGRPVSGVTTLRNGTMVVFRGHYFWVLDR
NKVPGEAQGITQVWGVPSPIDTVFTRCNCQGKTYLFKGNQYWRFDNGVVDPGYPKAIQVG
FDGLRGHITAALSVPQHRQRRESVYFFKRGGVVQKYSYRFTPSPTCGTQPKINIYANRNR
LARQAAGISMSSAINIRASWRGFPTAVTAAVSVPNKQEPDGYKYYAFSRATFYTVRMDSE
RPALAAPAANTSPQNNFFKCP
Download sequence
Identical sequences H3DL89
ENSTNIP00000021287 99883.ENSTNIP00000021287 ENSTNIP00000021287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]