SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3F8W1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3F8W1
Domain Number - Region: 29-93
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.00275
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3F8W1
Sequence length 99
Comment (tr|H3F8W1|H3F8W1_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA18613} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN= OC=Neodiplogasteridae; Pristionchus.
Sequence
KAKGDEIEKENENGDEKGKDNGLRKKTLKIKATMRDGKVKNLFAHMHTTVQALIVQAGAT
APCSLFHDGRKVAYARSLRSIESVVEAEKEAEEIEVDIY
Download sequence
Identical sequences H3F8W1
PPA02806 PPA18613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]