SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3FMB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3FMB9
Domain Number 1 Region: 2-26,115-192
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000413
Family CBS-domain pair 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3FMB9
Sequence length 278
Comment (tr|H3FMB9|H3FMB9_PRIPA) Uncharacterized protein {ECO:0000313|EnsemblMetazoa:PPA23425} KW=Complete proteome; Reference proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=WBGene00112979 OC=Neodiplogasteridae; Pristionchus.
Sequence
MNLIGSVSRHTLNSILDDQIGSSTRRAEASQRFYATMPYSDAAFDALHNSSSEKSACCNF
EERISLEGSSQESFKQKQINRYFEVKNKIYKYFRSCFGSSSPCAENSNSASKDDGGKHID
LIEHERIAWEQSRLTEIINVATLKIDTSPFVLPARTTLYKMHSLFSLLGLNRAYVVLRGH
LIGVIALREVREIVELGQSGLLRSLDSDDEESDDTGIPRDLQHLNVGLPGVVAHSIYDGD
DSDYEDNLQSQERKVMPEGDVLKSSHLGKYHKHIQNTK
Download sequence
Identical sequences H3FMB9
PPA23425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]