SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3GBB0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GBB0
Domain Number 1 Region: 270-290
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000119
Family Retrovirus zinc finger-like domains 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3GBB0
Sequence length 321
Comment (tr|H3GBB0|H3GBB0_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra72560} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MERSEFPHLNDSQFESVRKMGGIFGRDVLRGLASVTPAEQVKRVNAFDTYERELIAHVQG
NLQASVAEPKPVQPKPLRLAVPAFEVKEGENLHFWIREVEIAMGAGLISDQGLRVAFALS
NLSGRAKNWAYTLETTSPGCFASWEQLCERLRAAFLPANDAFRQRSRFLACKQGKRELYE
YVQEMRTLASSLVGNPLPEDVKTTVFTDGLKVGPARTQLFRVHASTMEEAIKIALQEEYS
HKQAGTPVVAQLVVANNEPEPMDLSSAELGLVRCYKCGGLGHYQRVCPSTGVGKNPSLKP
RGPNGRWRKPRPGGRGNSGHQ
Download sequence
Identical sequences H3GBB0
164328.JGI72559 164328.JGI72560 jgi|Phyra1_1|72559|fgenesh1_pg.C_scaffold_1000001 jgi|Phyra1_1|72560|fgenesh1_pg.C_scaffold_1000002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]