SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H3GHX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GHX2
Domain Number 1 Region: 111-139
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000502
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3GHX2
Sequence length 164
Comment (tr|H3GHX2|H3GHX2_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra75586} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAYHYQSLILRCKQGKRTLQDYVMELQNLEAAMAGAPLSEDVKVTVFMDGVRPGPVQPEL
FRIQPKTFNDAVHITIQEDRCVRSVQGYAGRAEATEGPTPMEISSTESARTQRNQRASCR
GFHCNQLGHFRRNCPTNPWKTDRGKAFLSLNMIEFAVFENGDSQ
Download sequence
Identical sequences H3GHX2
jgi|Phyra1_1|75586|fgenesh1_pg.C_scaffold_13000152 164328.JGI75586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]