SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3GRT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GRT4
Domain Number 1 Region: 183-210
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000816
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3GRT4
Sequence length 426
Comment (tr|H3GRT4|H3GRT4_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra79615} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVKSSNIAFGLMLLHMDADYHHVVDDCEEA
WVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSEGGNVLHHCNEVLNISAKLSSIGAKMED
EDVAICLLRSLPKSYENVVLNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATVKSEDAAK
AFNTDRESRQCTYCGKLGHTIDKCWTKQKDENRGPRRGGNGNGRGRGANNAQWRNDDASY
DYGYGYDRVAFAVSLECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERNEGELSVA
DGNKAAIMGVGTIVERVVLPNGDERDIEIKNALYVPSMSKNLLSVPQINKSDNQSCIKMT
KNPVNHGRAKHIDIKYHHIRDEVKRGEVKLEYCETSVMLADIMTKALAGPRHTELTAALG
IHGTSH
Download sequence
Identical sequences H3GRT4
jgi|Phyra1_1|79615|fgenesh1_pg.C_scaffold_42000025 164328.JGI79615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]