SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3GTT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3GTT3
Domain Number 1 Region: 57-86,133-210
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000785
Family Anti-sigma factor antagonist SpoIIaa 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3GTT3
Sequence length 244
Comment (tr|H3GTT3|H3GTT3_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra80577} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTFVAVNLVSLDVGMLIGVGIAILNFLLGYVRLPVVNRQPRTSDAARTLEERRVLEHKRD
AIAFFELSGFLFFGSSVQILDGVQKAVYVHKKLPGSDDEVGANYLGDADMPLTPEENRKP
LIECLDGTSVTDPDAVPTEYVVMDFTGVTAMDATAARSAFLILQKYCSNHNITVLYAGAL
PDIRDVLVKNEITGQESFYSSADSALKFCEDQLLRGVTGAETAAARVSSHREEAISLEVQ
GQPE
Download sequence
Identical sequences H3GTT3
164328.JGI80577 jgi|Phyra1_1|80577|fgenesh1_pg.C_scaffold_50000085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]