SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3H7F9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3H7F9
Domain Number 1 Region: 213-244
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000227
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H3H7F9
Sequence length 265
Comment (tr|H3H7F9|H3H7F9_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra86673} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MTTKRAEVLLGSGNYFHWEYNMRMTLARKGLLAHVQKVKAESEITEAWLVNDAKALGIIA
QGVELQHQTKIRSATRAIQAWGTLREFYNRTTLHNRVTMTRRLHDFKMDDGTSMAKHLDD
FDELVVGLQTMGEPVDEARQLVVLLSSLPAEYEMITSIIENAKDITLIEVKEKLLKEHER
LEKKDLATERAFKVNAGRFKGGKGDGRKWNVCKRNTGEFRGKCFKCNQPGHMKRDCPVRN
TGGDDDAVFAVGTERFNGWLIDSGT
Download sequence
Identical sequences H3H7F9
jgi|Phyra1_1|86673|fgenesh1_pg.C_scaffold_999000001 164328.JGI86673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]