SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3H7U2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H3H7U2
Domain Number - Region: 267-300
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000195
Family Retrovirus zinc finger-like domains 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3H7U2
Sequence length 310
Comment (tr|H3H7U2|H3H7U2_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra86826} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MPGMVDYEYDAEGDVRMTVPQPIFEVVAAPELAVWSQAAITTFIRERRQYEAKIAERCST
TGEVQETVARSIRTSLKPRVLEHVTHYILKKEVESVTDAMLLAEMKRKVGGMVNDRVPDV
SRLFAELKMDLEEVDVEARIAKYFMGFDRLVEDNGLTGMLGRGPAVGEAGRQRLKMRCKL
LLTHVTPEILKVDLTRLVELTHREAKVDDLALHDLMIERATRQQQYYLMQNEMKQSSSLR
PKEDGGAAAKAHGRPAKQLPKPSSIQGGGRGAAGPRKPPRDGCLVCKGPHWARDCPTATA
EQKANVEKML
Download sequence
Identical sequences H3H7U2
164328.JGI86826 jgi|Phyra1_1|86826|fgenesh1_pg.C_scaffold_1311000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]