SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3H7U8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3H7U8
Domain Number 1 Region: 1122-1342
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 5.87e-24
Family Reverse transcriptase 0.036
Further Details:      
 
Domain Number 2 Region: 721-751
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000000767
Family Retrovirus zinc finger-like domains 0.0049
Further Details:      
 
Weak hits

Sequence:  H3H7U8
Domain Number - Region: 527-554
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00017
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 
Domain Number - Region: 210-237
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000172
Family Retrovirus zinc finger-like domains 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H3H7U8
Sequence length 1362
Comment (tr|H3H7U8|H3H7U8_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra86833} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNRETTPSFTDSRPKDEYVK
SSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQKAGRIYLKRQLFSMEMSE
GGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYESVVLNLEMSSAELRSQD
VVKVLTNEHIKWQGEKTATVKTEDAAKAFNTDRESRQCTYCGKLGHTIDKCWTKQKDENR
GPRRGGNGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVSLECGISTGKDMLGMWAV
DSGATHHILLRVMSPSTMSSAHDASTKVSIDKFNGDNYATWNRYMRGVFLTKSVWHVVNR
ETTPSFTDSRPKDEYVKSSNIAFGLMLLHMDADYHHVVDDCEEAWVAWTRLKTLYGGSQK
AGRIYLKRQLFSMEMSEGGNVLHHCNEVLNISAKLSSIGAKMEDEDVAICLLRSLPKSYE
NVVMNLEMSSAELRSQDVVKVLTNEHIKRQGEKTATVKTEDAAKAFNTDRESRQCTYCGK
LGHTIDKCWTKQKDENRGPRRGGNGNGNGRGRGANNAQWRNDDASYDYGYGYDRVAFAVS
LECGISTGKDMLGMWAVDSGATHHICNDKAKFAHLIERNEGELSVADGVVKKAPRAAAVY
RLSESYQFLITALESRADSLSWELVTSRLLHEDMKRKEQGGGGVDGAAHGQGQAFMTRDN
KRKGRPVKKTGACHNCGKQGHWIAECPSRVHNDAERYRSQRANVAQDEENPGDYLFSVGR
TSSAAKPSDMWLVDSGATQHMTSSKTYMRNYKKMAPVDVHLADDGVVQAVGTGDIVMSMK
TPRGMKKGVLTNVWHIPKLSRNLFSVGRFTKDVGPVTFESDGCFADNKGLKWQLGAREGK
GLFKLCMTPMMPDEANAASSKDRQGDTTSYLWHLRLGHIGHGGLDAIVKKSYGVGIDMTS
VKQWELCDGCALGKQTRVSYMKSSPNRAKHVLEVVHSDVCGPMQTPTFGGKRYFSDEDDN
EEEEEEEAARDEDFGPGNKRHPRTQSLEEATEVPSAKRYASQSRHQTLDEMSAAAQESQD
FEAAYVVDSVGEMPTTFKSAMESSDAVKWKEACDSECDSLLKNDTWDVVPLPKGRKAIGC
RWVFRVKENQAGEIERFKARLVAKGFSQKYGIDYDETFAPVAKFTSIRIVLSLAAKYGLK
LHQMDVKTAFLNGVLDEDIYMTQPDGYVDEDHPDHVCKLKRSLYGLKQSPRMWNQTIDDF
MLKLGFKKCESDHCVYLKRNGQDMIFVALYVDDLVLASSNDELLESTKHALSKRFEMTDL
GELEYFLGMEIKNDHGSGKVTVRQTKFLKSILTKFGMQDSKP
Download sequence
Identical sequences H3H7U8
164328.JGI86833 jgi|Phyra1_1|86833|fgenesh1_pg.C_scaffold_1314000001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]