SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H3H8K0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H3H8K0
Domain Number 1 Region: 168-202
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000000183
Family Retrovirus zinc finger-like domains 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H3H8K0
Sequence length 260
Comment (tr|H3H8K0|H3H8K0_PHYRM) Uncharacterized protein {ECO:0000313|EnsemblProtists:Phyra87125} KW=Complete proteome; Reference proteome OX=164328 OS=Phytophthora ramorum (Sudden oak death agent). GN= OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MRRAGCVRVRTSVWERVQVHAAIVLNLNDSQLMHVVTSTTAKEAWDTLKKFHKTQDMANR
LWLKEKFSAFKFTASSVGKHVTELEKLVMEMKNAGCEPTEEDVCATMLRSLPSSYEALVQ
AFRMSVSEFKLADLVSKLIAEEVRQKDSNRIEEATALLAGKGNGKQQQKKKNARGMRKKG
PFGKCFNCGKPGHYARDCRSEASPDEDVQDQSNVAFHATEAFASECWVMDSDCAHHIERK
EQRELEDSRGWNSCSACLDW
Download sequence
Identical sequences H3H8K0
jgi|Phyra1_1|87125|fgenesh1_pg.C_scaffold_1590000001 164328.JGI87125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]