SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H5T6V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H5T6V2
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.88e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.0000947
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H5T6V2
Sequence length 107
Comment (tr|H5T6V2|H5T6V2_MELPD) Phosphotransferase system PTS protein {ECO:0000313|EMBL:BAL62895.1} KW=Complete proteome OX=1090974 OS=Melissococcus plutonius (strain DAT561). GN=MPD5_1713 OC=Melissococcus.
Sequence
MNKEEVQLLGFEIVAYSGDARSELLTLLNETRQGNFEHVNEHLKNVDENLKLAHNSQTQT
LADEAAGKNMEMGFIFIHGQDHLMTTLLFRDLIQDFIELYREKYQKN
Download sequence
Identical sequences H5T6V2
WP_014868579.1.26313 gi|399140297|ref|YP_006546398.1| gi|399140297|ref|YP_006546398.1|NC_018265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]