SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6LG13 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6LG13
Domain Number 1 Region: 158-344
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 2.35e-63
Family Methylesterase CheB, C-terminal domain 0.00000254
Further Details:      
 
Domain Number 2 Region: 7-109
Classification Level Classification E-value
Superfamily CheY-like 4.13e-26
Family CheY-related 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H6LG13
Sequence length 345
Comment (tr|H6LG13|H6LG13_ACEWD) Chemotaxis response regulator protein-glutamate methylesterase {ECO:0000256|HAMAP-Rule:MF_00099} KW=Complete proteome; Reference proteome OX=931626 OS=KCTC 1655 / WB1). GN=Awo_c15190 OC=Acetobacterium.
Sequence
MRDKKDQISVLIVDDSIFFREIVSRKLSMEPFIYVIATANNPFDARDKILKYDPDVVICD
VEMPKMNGIEFIRRLLPQYPLPVIVVSSNAGAAADAKKAGALYFVEKPKGDLAKTIEKFI
VELTKKIRIAAKMTVVIPRPLVVEEINQRLDDEAQFTDRIIAIGASTGGTEAIYEILKNL
PSNCPGIVIVQHIPPMFSKMFAQRLDAQTMFQCKEAATGDYLKNGWVYIAPGDKHMRVKR
IGKKYRIEVFEGERVNGHCPSVDILFESVAKEAGAQAIGVLLTGMGYDGAKGLLNIRRKG
ALTIGQDEATSVVYGMNKVAFNMGAVTIQASLEKIHTYILSAIKE
Download sequence
Identical sequences H6LG13
WP_014355904.1.36127 gi|379011378|ref|YP_005269190.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]