SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6NG82 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6NG82
Domain Number 1 Region: 171-566
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.18e-100
Family beta-Lactamase/D-ala carboxypeptidase 0.000022
Further Details:      
 
Domain Number 2 Region: 51-220
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 2.09e-44
Family Penicillin binding protein dimerisation domain 0.00066
Further Details:      
 
Domain Number 3 Region: 583-636
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000157
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H6NG82
Sequence length 652
Comment (tr|H6NG82|H6NG82_9BACL) SpoVD {ECO:0000313|EMBL:AFC32209.1} KW=Complete proteome; Reference proteome OX=1116391 OS=Paenibacillus mucilaginosus 3016. GN=PM3016_5513 OC=Paenibacillus.
Sequence
MRASNVTVRRRLFTALMVGTILFFALAVRLAYVQLWKGPDINKLAEESWRREIPVTSKRG
EILDRNGVQLAYNISSPTVMAVPAQIKDAEATAARLAAALGMDQAAILKQITSRQMSVYL
KPGGRKISLEKAKEIKEMNLPGVWVTEDNKRHYPFGELAAHVLGFTGAYNQGLTGIELKY
EKNLTGIKGNISYLADAAGKYMPGSTDEYKKPLDGLNLQLTIDSRIQQIMERELDQAMVK
FQPKHVIAIAMDPNNGEILAMGSRPGFDPGNFQASPVQNYNRNLPIWMTYEPGSTFKIIT
LAAALQEKKVNLTDPFHDPGSIEVAGARLRCWKRQGHGSETFLQVVENSCNPGFVVMGQK
LGKDVLLDYVSKFGFGKKTGIDLGGEENGIMFKPSRVGPVELATISFGQGVSVTPIQQIA
AVSAAVNGGKLFKPHVARAWYEPETGELVEAVQPELVRQVISEETSKQVRETLESVVANG
TGRNAFIDGYRVGGKTGTAQKVVNGRYSSSEHIVSFIGFAPADDPKVVIYAAVDDPQGIQ
FGGLIAAPLVKNIMEDTLRYMNVPQRKDQLDRKYVYGDTPIAVVPDLIGRSVSDIYEDLN
MNFTLAKSGTGTTVVNQVPKPGSRVDQGSTIRVYLSDAAPPPPVPKAGQTPQ
Download sequence
Identical sequences H6NG82
gi|379723227|ref|YP_005315358.1| WP_014371635.1.53882 WP_014371635.1.63014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]