SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6NK93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6NK93
Domain Number 1 Region: 434-543
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.46e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H6NK93
Sequence length 584
Comment (tr|H6NK93|H6NK93_9BACL) SulP family sulfate permease {ECO:0000313|EMBL:AFC31577.1} KW=Complete proteome; Reference proteome OX=1116391 OS=Paenibacillus mucilaginosus 3016. GN=PM3016_4841 OC=Paenibacillus.
Sequence
MLSDIRFQGYNASYLKRDLAAGLIVGIVAIPLGMAFAIASGVRPEYGIYTVILAGLLVSL
LGGSKFQIAGPTGAFVPILFAIVMEHGYENLLIAGFMAGIMLVLLGLFKLGSLMRYIPRP
VTIGFTTGIAVIIFSGQIAHFLGLRNVKKKEAFHENMREIAVHIETVNWYSVGTAVICLA
VLLMTSRLTTKVPPALAGLIAATLAAVLFFRGKIDTIGSTYGAIPTGLPTFKLPALSWDL
VVDLLPAAFVIAMLGGIESLLSAMVADRMGGDKHNSNKELIGQGIANMVTPLFGGIPATG
AIARTATNIKNGSASPLSGIIHALVVLVVLLVFAPYASHIPLAAMAPILMFVAWNMSERR
EFMHVLKTRTGDSVVLVVTFLLTVFADLTTAVGAGLVLAAVLFIKRMSGTLKLEGVLPDP
QDKLVKPAQGGEERSCPQIAIFTVEGPLFFGTSSAFLETIKDKLAAGGPQPILLLRMGKV
SDMDTTGEAALADIAEEVKARGGTLLLTGITPAVRPILDSSGLSAKIGEERLFRRTGEAI
AYALRRVSPARCLGCRQFTFDECTELSKPAPAAVRPDRAGVLQG
Download sequence
Identical sequences H6NK93
WP_014371251.1.63014 gi|379722595|ref|YP_005314726.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]