SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6NT70 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6NT70
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily FlgN-like 1.23e-16
Family FlgN-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H6NT70
Sequence length 166
Comment (tr|H6NT70|H6NT70_9BACL) Uncharacterized protein {ECO:0000313|EMBL:AFC27083.1} KW=Complete proteome; Reference proteome OX=1116391 OS=Paenibacillus mucilaginosus 3016. GN=PM3016_96 OC=Paenibacillus.
Sequence
MSFEALLDTMTELNEIHNSLLELAEQKRHVLIHNQVEQLMQIVTKENKMLKRIGELEQQR
VEVTGAFLMEKGYKPNPRVTVSDLTKILFNIEDKKLLLDKQKQLAAAIRKLRELNRVNQQ
MIEHSLAYIDYSLDLIVGPPEDEFVYKNPQAGASGPKRQGMFDSRA
Download sequence
Identical sequences H6NT70 I0BA22
gi|386720659|ref|YP_006186984.1| WP_014368100.1.53882 WP_014368100.1.63014 gi|379718101|ref|YP_005310232.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]