SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H6Q683 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H6Q683
Domain Number 1 Region: 4-156
Classification Level Classification E-value
Superfamily Resolvase-like 7.85e-28
Family gamma,delta resolvase, catalytic domain 0.0019
Further Details:      
 
Weak hits

Sequence:  H6Q683
Domain Number - Region: 159-205
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0382
Family Recombinase DNA-binding domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H6Q683
Sequence length 251
Comment (tr|H6Q683|H6Q683_PYROT) Site-specific recombinase, DNA invertase Pin-like protein {ECO:0000313|EMBL:AFA38186.1} KW=Complete proteome OX=698757 OS=Pyrobaculum oguniense (strain DSM 13380 / JCM 10595 / TE7). GN=Pogu_0159 OC=Thermoproteaceae; Pyrobaculum.
Sequence
MIPAVTYIRVSTEEQDPENQRQYLERWAAERGIYIVKHYIDVGVSGATQPWERPAFREMA
KEADVMEPRPRVLLVYEISRLVRNFQELFALLDVVENKLGLVVVSASEREQALQSLDGVY
RQFLRAVLAFVATMEREFIRQRTKTALERARTEGKIWNVAERHPELLEAVVSMYKSGASL
GEVARTFGLSTYEVRRLLSQAGVYRPSPHTCPRCFSRMKTVERTAKIVGGRYVVVERLYC
HNCGYEETREG
Download sequence
Identical sequences H6Q683
gi|379003121|ref|YP_005258793.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]