SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H7BWV5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7BWV5
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 2.35e-81
Family CutC-like 0.00000226
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H7BWV5
Sequence length 273
Comment (tr|H7BWV5|H7BWV5_BOVIN) CutC copper transporter {ECO:0000313|Ensembl:ENSBTAP00000003869} KW=Complete proteome; Reference proteome OX=9913 OS=Bos taurus (Bovine). GN=CUTC OC=Pecora; Bovidae; Bovinae; Bos.
Sequence
MKRQGASSERKRARIPSGKAGAANGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGVLQVVKQYVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALT
EDGHIDKELCMSLVALCRPLPVTFHRAFDMVHDPVAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIDQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNSSV
AMGASLSNSEYSLKVTDVTQVRTLNAIAKNILV
Download sequence
Identical sequences H7BWV5 W5PTA5
ENSBTAP00000003869 ENSOARP00000013686 NP_001193825.1.59421 NP_001193825.1.76553 XP_004020152.1.66739 XP_005980738.1.78601 XP_006064635.1.26621 XP_010857844.1.44457 XP_011975137.1.54773 XP_017896778.1.57651 XP_020752982.1.74333 ENSBTAP00000003869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]