SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H7C0M4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C0M4
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.0000392
Family DBL homology domain (DH-domain) 0.0092
Further Details:      
 
Weak hits

Sequence:  H7C0M4
Domain Number - Region: 182-251
Classification Level Classification E-value
Superfamily PH domain-like 0.0134
Family Pleckstrin-homology domain (PH domain) 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7C0M4
Sequence length 302
Comment (tr|H7C0M4|H7C0M4_HUMAN) ALS2 C-terminal-like protein {ECO:0000313|Ensembl:ENSP00000395749} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ALS2CL OC=Catarrhini; Hominidae; Homo.
Sequence
XLQERLRYPDSTGLESLLLLRGADRVLQAHIEYIESYTSCMVVQAFQKAAKRRSEYWRGQ
RKALRQLLSGVSSEGSVGASLGQALHQPLAHHVQQYVLLLLSLGDTIGEHHPTRELVVNA
VTLFGNLQSFMKQELDQAVATQALWHTLRGRLRDVLCTPAHRLLQDSQDVPVTVAPLRAE
RVLLFDDALVLLQGHNVHTFDLKLVWVDPGQDGCTFHLLTPEEEFSFCAKDSQGQAVWQW
KVTWAVHQALHGKKDFPVLGAGLEPSQPPDCRCAEYTFQAEGRLCQATYEGEWCRGRPHG
EP
Download sequence
Identical sequences H7C0M4
ENSP00000395749 ENSP00000395749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]