SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H7C280 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C280
Domain Number 1 Region: 16-145
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.05e-27
Family Cystathionine synthase-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H7C280
Sequence length 151
Comment (tr|H7C280|H7C280_HUMAN) Selenocysteine lyase {ECO:0000313|Ensembl:ENSP00000404473} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SCLY OC=Catarrhini; Hominidae; Homo.
Sequence
APAASQPSGCGKHNSPERKVYMDYNATTPLEPEVIQAMTKAMWEAWGNPSSPYSAGRKAK
DIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFHANQTSKGHTGGHHSPVK
GAKPHFITSSVEHDSIRLPLEHLVEEQVAGE
Download sequence
Identical sequences H7C280
ENSP00000404473 ENSP00000404473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]