SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H7C3G1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C3G1
Domain Number 1 Region: 70-207
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.76e-28
Family DBL homology domain (DH-domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) H7C3G1
Sequence length 209
Comment (tr|H7C3G1|H7C3G1_HUMAN) Protein ECT2 {ECO:0000313|Ensembl:ENSP00000411674} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=ECT2 OC=Catarrhini; Hominidae; Homo.
Sequence
XYVVKQEWFWGSIQMDARAGETMYLYEKANTPELKKSVSMLSLNTPNSNRKRRRLKETLA
QLSRETDVSPFPPHTPKSCTKSSKSSTPVPSKQSARWQVAKELYQTESNYVNILATIIQL
FQVPLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFL
KYSKDLVKTYPPFVNFFEMSKETIIKCEK
Download sequence
Identical sequences H7C3G1
ENSP00000411674 ENSP00000411674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]