SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H7C585 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H7C585
Domain Number 1 Region: 22-95
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 9.94e-27
Family Frataxin-like 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H7C585
Sequence length 108
Comment (tr|H7C585|H7C585_HUMAN) Frataxin, mitochondrial {ECO:0000313|Ensembl:ENSP00000419243} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=FXN OC=Catarrhini; Hominidae; Homo.
Sequence
XPDLECQKAECLFDEFEEIWNFGPPRSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSG
PKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
Download sequence
Identical sequences H7C585
ENSP00000419243 ENSP00000419243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]