SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for H8GRQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  H8GRQ9
Domain Number 1 Region: 4-122
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 3.5e-58
Family Nqo15-like 0.0000218
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) H8GRQ9
Sequence length 123
Comment (tr|H8GRQ9|H8GRQ9_DEIGI) NADH-quinone oxidoreductase subunit 15 {ECO:0000313|EMBL:AFD25106.1} KW=Complete proteome; Reference proteome OX=745776 OS=I-0). GN=DGo_CA1179 OC=Deinococcaceae; Deinococcus.
Sequence
MTHSDSALYAGWTELLGWLEAEAQARGLTYGKVADFPDYIYRMERPYDLPTTVMSAGVSS
GGQPLLVAAVSPRHADLKAVSLRLMGGSKHWHLHAGTRGLLEGKRPFTRERLGAVLDGAL
RGL
Download sequence
Identical sequences H8GRQ9
gi|386856387|ref|YP_006260564.1| WP_014684589.1.15941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]