SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for H9ENK9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  H9ENK9
Domain Number - Region: 103-259
Classification Level Classification E-value
Superfamily EF-hand 0.000682
Family Calmodulin-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) H9ENK9
Sequence length 292
Comment (tr|H9ENK9|H9ENK9_MACMU) Defective in cullin neddylation protein 1-like protein {ECO:0000256|RuleBase:RU363131} OX=9544 OS=Macaca mulatta (Rhesus macaque). GN=DCUN1D4 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Macaca.
Sequence
MHSDAAAVNFQLNSHLSTLANIHKIYHTLNKLNLTEDIGQDDHQTGSLRSCSSSDCFNKV
MPPRKKRRPASGDDLSAKKSRHDSMYRKYDSTRIKTEEEAFSSKRCLEWFYEYAGTDDVV
GPEGMEKFCEDIGVEPENVVMLVLAWKLDAQNMGYFTLQEWLKGMTSLQCDTTEKLRNTL
DYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLE
QSKYKVINKDQWCNVLEFSRTINLDLSNYDEDGAWPVLLDEFVEWYKDKQMS
Download sequence
Identical sequences A0A0D9QY34 A0A2K5JK26 A0A2K5MA45 A0A2K5ZSH7 A0A2K6BTH3 G3RFD7 H9ENK9 Q92564
9606.ENSP00000334625 ENSP00000334625 ENSP00000334625 ENSPANP00000010232 ENSGGOP00000014301 gi|94536778|ref|NP_001035492.1| ENSGGOP00000014301 NP_001035492.1.87134 NP_001035492.1.92137 XP_004038710.1.27298 XP_011770518.1.29376 XP_011815440.1.43180 XP_011839700.1.47321 XP_011928980.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]